General Information

  • ID:  hor005450
  • Uniprot ID:  P11184
  • Protein name:  Relaxin A chain
  • Gene name:  NA
  • Organism:  Balaenoptera acutorostrata (Common minke whale) (Balaena rostrata)
  • Family:  insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Balaenoptera (genus), Balaenopteridae (family), Mysticeti (parvorder), Cetacea (infraorder), Whippomorpha (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RMTLSEKCCQVGCIRKDIARLC
  • Length:  22(33-54)
  • Propeptide:  QSTNDLIKACGRELVRLWVEICGSVRWGQSALRMTLSEKCCQVGCIRKDIARLC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts with estrogen to produce dilatation of the birth canal in many mammals
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45882
  • Structure ID:  AF-P11184-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005450_AF2.pdbhor005450_ESM.pdb

Physical Information

Mass: 290187 Formula: C102H184N34O30S5
Absent amino acids: FHNPWY Common amino acids: C
pI: 8.69 Basic residues: 5
Polar residues: 7 Hydrophobic residues: 6
Hydrophobicity: 3.64 Boman Index: -4896
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 88.64
Instability Index: 627.73 Extinction Coefficient cystines: 250
Absorbance 280nm: 11.9

Literature

  • PubMed ID:  2910872
  • Title:  Cetacean relaxin. Isolation and sequence of relaxins from Balaenoptera acutorostrata and Balaenoptera edeni.